PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011090065.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 382aa    MW: 42288.1 Da    PI: 8.4265
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011090065.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.46.6e-41163240178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegCe+ l +ak+yhrrhkvCe+h+kap+v+v g+eqrfCqqCsrfh++ efDe+krsCrrrLa+hnerrrk+++
  XP_011090065.1 163 RCQVEGCEVVLLNAKDYHRRHKVCEMHAKAPKVVVLGIEQRFCQQCSRFHAVAEFDESKRSCRRRLAGHNERRRKSSQ 240
                     6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-34161225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.565161238IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-38162241IPR004333Transcription factor, SBP-box
PfamPF031102.0E-32164237IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MEYYYWNNNS TSTSNSNSAR GHNGNCCSIH AWESSWELAT SSSISATTSR ADWTSYTTLH  60
NSFNYPPSSS AASATDRQVG PSAFHALMLQ QQEKRNDPHY YKPDPLLTCL KLGKRHYFED  120
VPTPPPAAGP ASSVTKKGKP YYSTRGGPCS APLVGATPVV VPRCQVEGCE VVLLNAKDYH  180
RRHKVCEMHA KAPKVVVLGI EQRFCQQCSR FHAVAEFDES KRSCRRRLAG HNERRRKSSQ  240
EPQSLAKKHS QGRHAHFLNS SQCALSLLSS TNYNPWNITQ PSADLPARCS AALRELIAEN  300
RASILAGRQL MDGNYQVEDY CNNNTSVGVK SNSQESQGHV TLDLMQARNS ALGLLSVHDH  360
KASTEGDEEG CSDELWKLPL GY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-311642371184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090065.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X2
TrEMBLA0A068UPD16e-92A0A068UPD1_COFCA; Uncharacterized protein
STRINGVIT_15s0021g02290.t011e-78(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-37squamosa promoter binding protein-like 10